PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00426.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 587aa    MW: 64450.7 Da    PI: 8.256
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00426.1_g00011.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.21.3e-363594362
                   zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             +  lkcprCds ntkfCyynnyslsqPr++Ck+CrryWt+GGalrnvP+Gg++r+++k s
  Rsa1.0_00426.1_g00011.1 35 QPVLKCPRCDSVNTKFCYYNNYSLSQPRHYCKNCRRYWTRGGALRNVPIGGSTRNKNKPS 94
                             56789*************************************************988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-323292IPR003851Zinc finger, Dof-type
PfamPF027012.2E-313792IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2483892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene3DG3DSA:3.30.1330.307.5E-10304404IPR02906450S ribosomal protein L30e-like
SuperFamilySSF553157.77E-9305404IPR02906450S ribosomal protein L30e-like
SuperFamilySSF752176.41E-31433584IPR029028Alpha/beta knot methyltransferases
Gene3DG3DSA:3.40.1280.101.0E-40434586IPR029026tRNA (guanine-N1-)-methyltransferase, N-terminal
PfamPF005886.7E-30438584IPR001537tRNA/rRNA methyltransferase, SpoU type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006396Biological ProcessRNA processing
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
GO:0008173Molecular FunctionRNA methyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MMPSSHQSHT TSFKPLRIKK PPHQISRMGP SPAAQPVLKC PRCDSVNTKF CYYNNYSLSQ  60
PRHYCKNCRR YWTRGGALRN VPIGGSTRNK NKPSSLQVMS SRPPIVAPLS SHELADGFRM  120
NKAHIDPPAM AFSGGFSGYM FPLDPNYNLA SSSIESLSSL NQDLHQKLQQ QRLITSMFQQ  180
DSPPVMFHNA ELLTPSTATT EWAFDRSAMG GAAACGINES NDDREASPDE QSSSPLTSPS  240
EKTTKMHCGC AFATPALSPR LPFEIKTSLP KLRASSAHIQ INHPDDLTDK SPATRVTLPS  300
HVDSITSTSN PFVKHCSKLR QIASYRRAHG SVLVVGAIPI REVCMFLTNK QGVTATEIDC  360
LLLHEEAQIP LGLESLSIRI VRVSSLVMKK LSGVQSTESV EAVALMRIPS SFINLEDDDE  420
DMIITRDCDK WFPSAHRVLV LDNIQDPGNL GTLIRSAMAF NWDGAFLLPG CCDPFNDKAL  480
RASRGASFQL PLVSGNWNHL QLLQRGFQMK LLAGHPASAT KKPVSKLSLE FTQSLADKPL  540
CLILGSEGQG LSEQSRQVCE LVSIPMESEF ESLNVSVAGG IFLFMLQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638245.10.0PREDICTED: uncharacterized tRNA/rRNA methyltransferase slr1673
TrEMBLA0A078BX150.0A0A078BX15_BRANA; BnaC01g01030D protein
STRINGBra011801.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38000.13e-99DNA binding with one finger 4.7